DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP001198

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_321961.2 Gene:AgaP_AGAP001198 / 1281971 VectorBaseID:AGAP001198 Length:260 Species:Anopheles gambiae


Alignment Length:251 Identity:76/251 - (30%)
Similarity:114/251 - (45%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQ-----GISGAHSCGGAIINETFVLTAAHCVEN-AFIPWLVVVTGTN 96
            ||.|..|.....|||:|||     |....|.|.|:|||:.::||||||:|. ....|..||.|.|
Mosquito    23 IIEGTEANLHEFPYQVSLQWNFNNGSRARHFCSGSIINQRWILTAAHCLEEYTKDGWFEVVAGVN 87

  Fly    97 K--YNQPGG-RYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVI- 157
            .  :.:.|. |..:.....|.:||...:..||.:|:|..|:   :.|:.|  ..:.:...|.:| 
Mosquito    88 NIAHEEAGAQRRNVTRYEQHESYDLSAIRYDIGVLQLSHPL---DLTRNI--KTMRLATKDTLIH 147

  Fly   158 -----LTGWGS-TVLWGTSPIDLQVLYLQYVPHRECKA--LLSNDEDC------DVGHICTFSRL 208
                 ..|||| :..|       :.:|    |.:..|.  :|..:|||      |...||.....
Mosquito   148 QKIAKFAGWGSISKTW-------EDIY----PDKLMKVNLILRTEEDCQTIGKIDETQICAGGYK 201

  Fly   209 GEGACHGDSGGPLV----SNGYLVGLVNWG-WPCATGVPDVHASVYFYRDWIRNVM 259
            ....|..||||||.    .....:|::::| .||...:|.|::||.::.|||::.:
Mosquito   202 NVSGCTADSGGPLTVTIDGEQMQIGVLSYGEKPCQARLPIVYSSVMYFHDWIQDAI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/245 (30%)
Tryp_SPc 38..258 CDD:238113 76/248 (31%)
AgaP_AGAP001198XP_321961.2 Tryp_SPc 23..255 CDD:238113 76/247 (31%)
Tryp_SPc 23..253 CDD:214473 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.