DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP001199

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_321960.2 Gene:AgaP_AGAP001199 / 1281970 VectorBaseID:AGAP001199 Length:268 Species:Anopheles gambiae


Alignment Length:279 Identity:87/279 - (31%)
Similarity:127/279 - (45%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ------GISGAHSCGGA 67
            ||.|:.|..:.|..:....:      ..:|:||:.|.....|||||||      .....|.|||:
Mosquito     4 LLRLAALAVVLAALVAAKPS------RPKIVGGEEAIAHEFPYQISLQWNYNNDEQDPFHFCGGS 62

  Fly    68 IINETFVLTAAHCVENAFIP--WLVVVTGTNKYNQPGG---RYFLKAIHIHCNYDNPEMHNDIAL 127
            :|.|.|||||.|||.:|..|  :...|.|.:.::|...   |..:..:::|.:|:.....||||:
Mosquito    63 LIAEKFVLTAGHCVPSAISPDGFPEAVAGEHDFSQYDAGVQRRRIAEMYVHEDYEGSVGPNDIAI 127

  Fly   128 LELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGST-----------VLWGTSPI-DLQVLYLQ 180
            ..:.:|...:...|.:.||.....|..|..::|||||           ::..|.|| ||:|    
Mosquito   128 FRVDKPFHLNRNIQLVTLPEPNAIPTGETTISGWGSTSFSFEPSYPNILMKTTLPIMDLEV---- 188

  Fly   181 YVPHRECKALLSNDEDCDVGHICTFSRLG-EGACHGDSGGPLV---SNGYLVGLVNWGW-PCATG 240
                  |:.:...:...| .:||..:..| ...|.||||||||   .....||:|:||. ||. |
Mosquito   189 ------CRKIYFTETVAD-SNICAGTMEGTSSVCSGDSGGPLVQIDDEIVQVGIVSWGGIPCG-G 245

  Fly   241 V--PDVHASVYFYRDWIRN 257
            .  |.|...|.::.|||.:
Mosquito   246 YKNPGVFVRVSYFIDWIND 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/247 (32%)
Tryp_SPc 38..258 CDD:238113 82/250 (33%)
AgaP_AGAP001199XP_321960.2 Tryp_SPc 26..262 CDD:214473 80/247 (32%)
Tryp_SPc 27..265 CDD:238113 82/250 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.