DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP001244

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_321898.3 Gene:AgaP_AGAP001244 / 1281920 VectorBaseID:AGAP001244 Length:279 Species:Anopheles gambiae


Alignment Length:207 Identity:65/207 - (31%)
Similarity:96/207 - (46%) Gaps:17/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLV-VVTGTNKYN 99
            ::|:||:........||:||:... .|.||.:||:..:.||||||:.....|..: ::.||...:
Mosquito    52 KKIVGGEPVSIETHVYQLSLRSYD-YHICGASIISSVWALTAAHCLFPDPDPRTISLLAGTGSQS 115

  Fly   100 QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDER--TQPIPLPLVPMQPGDEVILTGWG 162
            ..|..|....|.||..|....|.||:|::.:....:....  ...:||...|| .|...|:||||
Mosquito   116 TGGRIYNATRIIIHPMYAPSTMDNDVAVIRVNTHFSGPNTGYIGVVPLGYEPM-AGVRAIVTGWG 179

  Fly   163 STVLWGTSPIDLQVLYLQYVPHRECK-----ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV 222
            .........:.|..:.:..|...||.     .|:|....|       ...||:.:|:||||||||
Mosquito   180 RQSEGAKQSMTLAGVEIPIVDKAECMDQWSGVLVSPQMIC-------AGELGKDSCNGDSGGPLV 237

  Fly   223 SNGYLVGLVNWG 234
            |.|..:|:|:||
Mosquito   238 SGGRQIGIVSWG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/206 (32%)
Tryp_SPc 38..258 CDD:238113 65/205 (32%)
AgaP_AGAP001244XP_321898.3 Tryp_SPc 53..266 CDD:214473 65/206 (32%)
Tryp_SPc 54..276 CDD:238113 65/205 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.