DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP001365

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_321778.5 Gene:AgaP_AGAP001365 / 1281817 VectorBaseID:AGAP001365 Length:608 Species:Anopheles gambiae


Alignment Length:261 Identity:73/261 - (27%)
Similarity:110/261 - (42%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV------ENAFIPWLVVVTGT 95
            |||||..:..|..|:.:::. :...:.|||:||...::||||||:      |...:....|.||.
Mosquito   363 RIIGGVTSNQGEHPWHVAIY-LDEEYQCGGSIIGRRWILTAAHCLTRQNTNETLDVDLFRVYTGI 426

  Fly    96 NKYNQPGGRYFLKA--IHIHCNYDNPEMH-NDIALLELVEPIAWDERTQPIPL--PLVPMQP--G 153
            ...:.....::..|  :.:|.:| ||.|: .||.||.|...|.::...:|:.|  ..|.:..  |
Mosquito   427 IDISTIDDHFYRTADEVIVHRDY-NPVMYTTDIGLLRLKRNITYNSFIKPVCLYNRTVDISTFYG 490

  Fly   154 DEVILTGWG-------STVLWGTSPIDLQVLYLQYVPHREC-------KALLSNDEDCDVGHICT 204
            .|..:||||       |.|        |..|.:..|..:.|       ..:|:..|....||.. 
Mosquito   491 REGKVTGWGFNRDGVISNV--------LNYLEVPVVSQKMCSQRNVQFNGVLAVGESFCAGHAD- 546

  Fly   205 FSRLGEGACHGDSGGPLV-SNG---YLVGLVNWGWP------CATGVPDVHASVYFYRDWIRNVM 259
                |...|:|||||.|| :.|   |:.|:|:....      |......|...|..:.:|||..:
Mosquito   547 ----GNSVCNGDSGGGLVFAEGPRYYVRGIVSISAQRRNLLLCDPNQYSVFTDVSKFLNWIRQQV 607

  Fly   260 S 260
            |
Mosquito   608 S 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/254 (27%)
Tryp_SPc 38..258 CDD:238113 71/256 (28%)
AgaP_AGAP001365XP_321778.5 GD_N 42..144 CDD:292649
GD_N 190..297 CDD:292649
Tryp_SPc 363..603 CDD:214473 69/254 (27%)
Tryp_SPc 364..606 CDD:238113 71/256 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.