DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP001395

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_321740.5 Gene:AgaP_AGAP001395 / 1281782 VectorBaseID:AGAP001395 Length:268 Species:Anopheles gambiae


Alignment Length:276 Identity:78/276 - (28%)
Similarity:115/276 - (41%) Gaps:60/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV---ENAFI--PWLVVVT 93
            :.|||:||..:..|...|..||.. .|.|.||.:|:|:.::|||.|||   .|..:  ..:..|.
Mosquito     8 QQQRIVGGVNSNRGQITYIASLTK-RGGHFCGASIVNDRWLLTAGHCVCSGVNKILRANQIQAVL 71

  Fly    94 GTNKYNQPGGRYF-------------LKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPL 145
            |..:.::.||...             ::.|..|..|...:..||||||||...|.:....:||.|
Mosquito    72 GLYRRSEFGGNQIDSDPFSDRAYEVGIRTIVPHPGYVCNKPSNDIALLELARRIDFSASVRPICL 136

  Fly   146 PL----VPMQPGDEVILTGWGSTVLW-------GTSPIDLQVLYLQYVPHRECKAL--------- 190
            ..    .....|...::.|||    |       |.....||...:....:.||:::         
Mosquito   137 SSGADGSARVEGQTAVVAGWG----WQQENRNLGDKADTLQRAVVDVFRNEECESMYRRGNRSRT 197

  Fly   191 LSNDEDCDVGHICTFSRLGEG-----ACHGDSGGPLV-SNGYLVGLVNWGWPCA-TGVPDVHASV 248
            ::..:.|          .|:|     ||..||||||| |:..|:|:|:.|..|| .|.|.::..|
Mosquito   198 IARTQLC----------AGKGTGGVDACWADSGGPLVTSDNVLIGIVSTGIGCARPGFPGIYTRV 252

  Fly   249 YFYRDWIRNVMSGNSK 264
            ..|..||..|:...|:
Mosquito   253 SEYASWIVTVIDRLSR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/262 (28%)
Tryp_SPc 38..258 CDD:238113 74/264 (28%)
AgaP_AGAP001395XP_321740.5 Tryp_SPc 11..259 CDD:214473 73/262 (28%)
Tryp_SPc 12..259 CDD:238113 72/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.