DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP001924

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_321140.5 Gene:AgaP_AGAP001924 / 1281201 VectorBaseID:AGAP001924 Length:381 Species:Anopheles gambiae


Alignment Length:317 Identity:85/317 - (26%)
Similarity:138/317 - (43%) Gaps:63/317 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQR---IIGGQAAEDGFAPYQISLQ---GISGAH 62
            |:.|..|.:.||:|..||:..|      ..|.:|   |:||:.|..|..|:..:|.   |.:...
Mosquito     7 VLPLAFLLMIGLLSAEAIQRCG------VRKVKRVNLILGGRNATAGKWPWHATLMHRAGDAKKL 65

  Fly    63 SCGGAIINETFVLTAAHCVENAF----IPWLVVVTGTNKYN--QPGGR-YFLKAIHIHCNYDNPE 120
            :|||.||::..:||||||:.:..    :..|||:.|..:.:  :|..| |..:.:.:|..|....
Mosquito    66 ACGGNIIDKHTILTAAHCLYDRHKLIALDRLVVILGRTELSVEEPWSRSYAPERLILHPGYKQAN 130

  Fly   121 MHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVI------LTGWGSTVLWGTSP--IDLQVL 177
            :.:|||:::|...|...:..  .|:.|.|...|.|.|      :.|:|......||.  :|::| 
Mosquito   131 VKDDIAMVKLASEITMSDYI--FPVCLWPRGLGHEDITGRKGFVVGYGLNDAGSTSNHLLDVEV- 192

  Fly   178 YLQYVPHRECKALLSNDEDCDVGH-----ICTFSRLGEGACHGDSGGPLV----SNGYLVGLVNW 233
              ..|....|   |.::.|.....     :|..:|.|.|.|:|||||.:.    :..::.|:|::
Mosquito   193 --PVVDRWTC---LESNRDTLSSQLASTMLCAGARDGVGPCNGDSGGGMFFMAGNEWHIRGIVSF 252

  Fly   234 GWPCATGVPD-------VHASVYFYRDWIRNVMSGN----------SKCTGFSSNQS 273
            . |...|...       ::..|..|.|||.|.: ||          :..|.|...|:
Mosquito   253 A-PNLDGTDKCDPKQYAIYTDVAKYLDWIANKL-GNVTQGTTSESLANSTDFPEGQT 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 67/254 (26%)
Tryp_SPc 38..258 CDD:238113 68/253 (27%)
AgaP_AGAP001924XP_321140.5 Tryp_SPc 38..283 CDD:238113 68/253 (27%)
Tryp_SPc 38..280 CDD:214473 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.