DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP011669

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_320844.4 Gene:AgaP_AGAP011669 / 1280970 VectorBaseID:AGAP011669 Length:576 Species:Anopheles gambiae


Alignment Length:284 Identity:74/284 - (26%)
Similarity:128/284 - (45%) Gaps:42/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLVSITAIRIKGNSTDGRFYKDQRII-GGQAAEDGFAPYQISL---QGISGAHSCGG 66
            :.:||||..:||.|..:....:...|....|.:| .|..|:.|..|:.::|   :.....::|||
Mosquito     8 ITLLLGLLCVVSQTRGQENHLTCGKRKVVSQYLIHNGIDAKAGHWPWHVALFHRKDAQYEYACGG 72

  Fly    67 AIINETFVLTAAHCVEN----AFIPWLVVVTG------TNKYNQPGGRYFLKAIHIHCNYDNPEM 121
            :|::|..:|||:|||..    ..|..:.|..|      :::|.|   .:.::.|.:|..:....:
Mosquito    73 SILDENTILTASHCVYTQSGVISISRVSVDVGRIHLNESSEYTQ---THLVREIIVHPGFSKNSI 134

  Fly   122 HNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPID-----LQVLYLQY 181
            .|||||::|...|..::..||:  .|..|....|:|:...|:.|.:|.:..|     |:...:..
Mosquito   135 VNDIALIKLSSNITMNKYVQPV--CLWTMDSNQELIVGRNGTIVGFGVNEQDVVSEQLKQALIGV 197

  Fly   182 VPHRECKALLSNDEDCDVGHI-----CTFSRLGEGACHGDSGGPLV----SNGYLVGLVNWGWPC 237
            |....|   :::|......|:     |...:.|..||:|||||.:.    ...::.|||:: .|.
Mosquito   198 VDPLSC---IADDRGVFGTHLTSDMFCGKGQKGVSACNGDSGGGMFFEIGGKWFVRGLVSF-TPL 258

  Fly   238 ATGVPD-----VHASVYFYRDWIR 256
            .|...|     .:..|..|.:||:
Mosquito   259 GTEQCDSLKNTAYTDVAKYLEWIK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 63/250 (25%)
Tryp_SPc 38..258 CDD:238113 65/252 (26%)
AgaP_AGAP011669XP_320844.4 Tryp_SPc 41..282 CDD:238113 64/249 (26%)
Tryp_SPc 43..281 CDD:214473 62/246 (25%)
Tryp_SPc 330..568 CDD:214473
Tryp_SPc 330..568 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.