DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP012020

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_320509.4 Gene:AgaP_AGAP012020 / 1280648 VectorBaseID:AGAP012020 Length:753 Species:Anopheles gambiae


Alignment Length:235 Identity:69/235 - (29%)
Similarity:97/235 - (41%) Gaps:68/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CGGAIINETFVLTAAHCV--ENAFIPWLVVVTGTNKYNQPGGRYF--LKAIHI--HCNYDNPEMH 122
            |||::|.|.|:||||||.  ||...|.:..:...|.|:.....|.  ||.:.:  |.||.....:
Mosquito    49 CGGSLIRENFILTAAHCTADENNTPPDVARMGDLNIYSNADNEYAQELKIVDVIRHPNYKFTSSY 113

  Fly   123 NDIALLELVEPIAWDERTQPIPLPLVP--MQPGDEV-----ILTGWGSTVLWGTSPIDLQVLY-L 179
            .||||::|       ||...:...::|  :...||:     :..|||.|   |.|....::|. :
Mosquito   114 YDIALMKL-------ERNVSVTRYVIPTCLWLEDEIRFPNLMAAGWGRT---GFSENTSEILMKV 168

  Fly   180 QYVPHRECKA-------------------LLSNDEDCDVGHICTFSRLGEGACHGDSGGP----- 220
            |..|.||.|.                   |.:.||:.|             .|.||||||     
Mosquito   169 QLSPVREDKCLKHYRKGDYKYRNGLLDHQLCAGDEEMD-------------TCPGDSGGPLHVML 220

  Fly   221 -----LVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWI 255
                 ||.  :|||:.::|..|....|.|:..|..:.|||
Mosquito   221 LKDKKLVP--FLVGVTSFGKICGVPAPGVYIKVSKFGDWI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 67/233 (29%)
Tryp_SPc 38..258 CDD:238113 69/235 (29%)
AgaP_AGAP012020XP_320509.4 Tryp_SPc 17..258 CDD:214473 67/233 (29%)
Tryp_SPc 18..261 CDD:238113 69/235 (29%)
Tryp_SPc 317..536 CDD:304450
Trypsin 323..533 CDD:278516
Tryp_SPc 641..>732 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.