DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP012270

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_320269.4 Gene:AgaP_AGAP012270 / 1280418 VectorBaseID:AGAP012270 Length:862 Species:Anopheles gambiae


Alignment Length:288 Identity:81/288 - (28%)
Similarity:120/288 - (41%) Gaps:54/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLSGLVSITAIRIKGNSTDGRFYKDQR-------IIGGQAAEDGFAPYQ-ISLQGISGA--HS 63
            ||.|||::.:.:..:..|    |....:|       |..|..|..|..|:. :..|..:||  :.
Mosquito     8 LLLLSGVLCVWSQTVGVN----RLVCGRRKVKSVYLIHNGIDAMPGHWPWHAVIYQRANGAEEYK 68

  Fly    64 CGGAIINETFVLTAAHCV---ENAFIP-WLVVVTG------TNKYNQPGGRYFLKAIHIHCNYDN 118
            |||:||:|..:||:.|||   ..|..| .|.:..|      ..:|.|..|   ::.:.:|...:.
Mosquito    69 CGGSIIDEDTILTSGHCVTVGSRAISPEQLSIEVGRIRLHERTEYTQTHG---VRQVIVHPGLNV 130

  Fly   119 PEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPID-----LQVLY 178
            ....|||||::|...|......|||  .|..|....|:|:...|:.:.:|.:..|     |:...
Mosquito   131 RRFKNDIALIKLASNITMTPHVQPI--CLWTMDNNQELIVGKNGTVLGFGLTEQDVVSEQLKQAS 193

  Fly   179 LQYVPHRECKALLSNDEDCDVGHI-----CTFSRLGEGACHGDSGGPL---VSNGYLV-GLVNWG 234
            :..|....|   |:||......::     |...|.|..||:|||||.|   |...:.| |:|:: 
Mosquito   194 IGVVDTLTC---LANDRAAFGTYLTSEMFCGGGRDGVSACNGDSGGGLFLEVEGRWFVRGIVSF- 254

  Fly   235 WP-------CATGVPDVHASVYFYRDWI 255
            .|       |.|......|.|..|..||
Mosquito   255 IPLRKNTALCDTSKFTAFADVAKYLKWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/258 (28%)
Tryp_SPc 38..258 CDD:238113 73/252 (29%)
AgaP_AGAP012270XP_320269.4 Tryp_SPc 40..284 CDD:238113 73/252 (29%)
Tryp_SPc 42..282 CDD:214473 70/248 (28%)
Tryp_SPc 329..>443 CDD:304450
Tryp_SPc 614..842 CDD:304450
Tryp_SPc 614..839 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.