DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP012328

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_320219.3 Gene:AgaP_AGAP012328 / 1280372 VectorBaseID:AGAP012328 Length:324 Species:Anopheles gambiae


Alignment Length:279 Identity:80/279 - (28%)
Similarity:116/279 - (41%) Gaps:81/279 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAH-------SCGGAIINETFVLTAAHCVENAFIPWLVVV 92
            |.||:|||.......|:...||.|:  |       :||||::|..|||:||||       ::.:.
Mosquito    60 DNRIVGGQRTSIDQYPWMALLQYIN--HRKGTKRFACGGALLNRKFVLSAAHC-------FVRLP 115

  Fly    93 TGTNKYNQPGGRY------------------------FLKAIHIHCNY--DNPEMHNDIALLELV 131
            .|...:....|.:                        ..:.|.||..|  ::.:..|||||:||.
Mosquito   116 AGVELHKVRLGEWDTDSEIDCEDLDDELSCASPVQDLDYERIIIHEGYTGNHADRENDIALIELS 180

  Fly   132 EPIAWDERTQPIPLPLVPMQPGDEVI------LTGWGSTVLWGTSPIDLQVLYLQYVP------- 183
            ....:::..:||.|| .|..|..|.:      ..|||.|.....|...|      |||       
Mosquito   181 GSAKYNDFVKPICLP-EPGTPNKEKLYFGSMWAAGWGRTETASGSRFKL------YVPLDLFDLQ 238

  Fly   184 ------HRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSN----GYLVGLVNWGWP-- 236
                  .|..|..|:..:.|.:|      ..|:..|:|||||||:..    .|:||:|::| |  
Mosquito   239 SCNETYQRRVKVPLTETQFCAMG------TPGKDTCNGDSGGPLMKTMKTLHYVVGVVSFG-PQR 296

  Fly   237 CATGVPDVHASVYFYRDWI 255
            |.:|:|.|:..|..:.|||
Mosquito   297 CGSGIPAVYTRVDKFYDWI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/275 (28%)
Tryp_SPc 38..258 CDD:238113 78/276 (28%)
AgaP_AGAP012328XP_320219.3 CLIP 1..45 CDD:295450
Tryp_SPc 62..315 CDD:214473 77/275 (28%)
Tryp_SPc 63..315 CDD:238113 76/274 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.