DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP009220

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_319997.4 Gene:AgaP_AGAP009220 / 1280178 VectorBaseID:AGAP009220 Length:325 Species:Anopheles gambiae


Alignment Length:267 Identity:80/267 - (29%)
Similarity:115/267 - (43%) Gaps:66/267 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNK 97
            |.|.:|..||.|:....|:...|:..:|:..|||.:|||.:|||||||:.|..:..:.:      
Mosquito    75 YTDDKISFGQDAKLFQFPWMALLKSKAGSFFCGGTLINERYVLTAAHCLVNNDVASVRL------ 133

  Fly    98 YNQPGGRYFLKAIHIHCN---------YDNP--------------EMHNDIALLELVEPIAWDER 139
                 |.|.|.:. |.||         .|.|              ::| ||.|:.|....:.::.
Mosquito   134 -----GEYDLNST-IDCNKHGDCAPAPQDIPVERAISHEDYSARYKLH-DIGLIRLARRASLNDN 191

  Fly   140 TQPIPLPLVPMQPGDEVI--LTGWGST--VLWGTSPIDLQVLYLQYVPHREC-KAL--------L 191
            ..||.||:.|.....:.|  :.|||.|  .|:...   ||...|..:.:.|| |.|        :
Mosquito   192 VLPICLPVTPAFLTKQTIFFVVGWGQTQNALFANK---LQFTKLDLMANDECLKQLRPKDRFVRI 253

  Fly   192 SNDEDCDVGHICTFSRLGEGACHGDSGGPL----VSNGYLV--GLVNWGW-PCA-TGVPDVHASV 248
            |:.:.|.:|     |.|.:. |.|||||||    :.|...|  |:|::|. .|. ...|.|:..|
Mosquito   254 SDSQLCAIG-----SNLSDN-CSGDSGGPLKSISIQNSRYVQYGVVSFGLRTCGKQSAPGVYTRV 312

  Fly   249 YFYRDWI 255
            ..|.|||
Mosquito   313 ERYVDWI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/261 (29%)
Tryp_SPc 38..258 CDD:238113 78/262 (30%)
AgaP_AGAP009220XP_319997.4 Tryp_SPc 83..319 CDD:214473 75/257 (29%)
Tryp_SPc 83..319 CDD:238113 75/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.