DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CLIPB12

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_319994.4 Gene:CLIPB12 / 1280175 VectorBaseID:AGAP009217 Length:341 Species:Anopheles gambiae


Alignment Length:245 Identity:59/245 - (24%)
Similarity:97/245 - (39%) Gaps:39/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAED----GFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV--ENAFIPWLVVVTGT 95
            |:...::.|:    |..|:...|:..||.:.|.|.:|::.:|||.|.|:  :|     |..|...
Mosquito   104 RMHSNESVENNGTLGKLPWIALLKTSSGEYHCAGTLISKRYVLTTAFCIISKN-----LAFVQLR 163

  Fly    96 NKYNQPGGRYFLKAIHI-------HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP-MQP 152
            .|.....|...||...|       |.:.:.|.:.|:|.|:.|....:::...:||.||:.| .|.
Mosquito   164 KKDCDERGACTLKPQDIPIERTIGHDSSNKPWLFNNIGLVRLARDASFNSDVRPICLPMGPEYQT 228

  Fly   153 GDE--VILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLS----NDEDCDVGHICTFSRLGEG 211
            .|.  .|:|......|..|..:.:..::|  |.:..|::.|.    |.:      :|........
Mosquito   229 TDTKYFIVTRKEDYALLDTDAVAISEVHL--VANEYCQSWLQRTVHNSQ------MCAIELAPND 285

  Fly   212 ACHGDSGGPLVS---NG--YLVGLVNWGWP-CATGVPDVHASVYFYRDWI 255
            .|....|..|.:   ||  .:.|...:|.. |......|:..|..:.|||
Mosquito   286 DCAKPYGASLTAQARNGRHVMYGAHAFGMDICTQNESTVYTRVESFVDWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 57/243 (23%)
Tryp_SPc 38..258 CDD:238113 58/244 (24%)
CLIPB12XP_319994.4 Tryp_SPc 118..338 CDD:304450 57/231 (25%)
Tryp_SPc 118..335 CDD:214473 55/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.