DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP009211

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_319989.4 Gene:AgaP_AGAP009211 / 1280170 VectorBaseID:AGAP009211 Length:265 Species:Anopheles gambiae


Alignment Length:271 Identity:82/271 - (30%)
Similarity:115/271 - (42%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQ-GISGAHSCGGAIINETFVLTAAHCV------------------ 81
            |.|..||.|.....|:...|: .:|....|||::|::..:|||||||                  
Mosquito     7 QLIAYGQPARAYAFPWMALLETSVSDDLPCGGSLISDRHILTAAHCVKARKRDCDDRIHFKDDEY 71

  Fly    82 -----ENAFIPWLVVVTGTNKYN----QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWD 137
                 |.|        .|. :|:    .|..|..::.|..|..|......||:|::.|..|....
Mosquito    72 DSGESEEA--------DGA-EYSASCGPPAQRIPIETIVTHPKYSARSKRNDLAIIRLQYPAIIG 127

  Fly   138 ERTQPIPLPLVPM----QPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDED-- 196
            ....||.|||...    :|.|..: ||||.|.....|.: |:...|..:|..:| |:...:.|  
Mosquito   128 YNVIPICLPLTEQLRAYRPADSFV-TGWGLTETGQRSAV-LRYAILPALPLPDC-AMRIKELDRI 189

  Fly   197 --CDVGHICTFSRLGEGACHGDSGGPL--VSNG---YLVGLVNWG-WPCATGV-PDVHASVYFYR 252
              .|.||:|.........|||||||||  ||:.   .|.|:|::| ..|.|.: |.|.|:|..:.
Mosquito   190 IVLDDGHLCAGGNNRTAHCHGDSGGPLQYVSDSTRFVLQGVVSFGVKTCGTKIAPGVFANVTHFI 254

  Fly   253 DWI---RNVMS 260
            |||   .||::
Mosquito   255 DWIVQEANVLN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/260 (30%)
Tryp_SPc 38..258 CDD:238113 79/265 (30%)
AgaP_AGAP009211XP_319989.4 Tryp_SPc 9..257 CDD:214473 77/259 (30%)
Tryp_SPc 9..257 CDD:238113 77/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.