DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP009121

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_319873.4 Gene:AgaP_AGAP009121 / 1280073 VectorBaseID:AGAP009121 Length:269 Species:Anopheles gambiae


Alignment Length:273 Identity:96/273 - (35%)
Similarity:130/273 - (47%) Gaps:28/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVVLLILLGLSGLVSITAIRIKGNSTDGRF-YKDQRIIGGQAAEDGFAPYQISLQG---ISGAHS 63
            ||.||.|:.    |:..|.|    |...:: :...|::||..|..|..|..:|:|.   :...|.
Mosquito     4 AVALLCLVA----VAAAAPR----SLQAKYGFPSGRVVGGIDALPGEFPSIVSIQRVILVVSTHI 60

  Fly    64 CGGAIINETFVLTAAHCV-ENAFIPWLVVVTGT-NKYNQPGGRYFLKAIH--IHCNYDNPEMHND 124
            |||:|::..:|||||||: ||.......:..|| |.......|..:....  :|.:|.......|
Mosquito    61 CGGSILSNFWVLTAAHCITENPATANFAIWAGTHNTAITEDTRQVISVASSTVHPDYQGGVNPTD 125

  Fly   125 IALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPI---DLQVLYLQYVPHRE 186
            ||::.|..|:.:..|.||:.||.....|.....|.|||||  .||.|.   .||.:....:|..|
Mosquito   126 IAVMRLAAPLTFTPRIQPVVLPAPGSTPSGPATLAGWGST--GGTLPTLPNILQKVTKPIIPFEE 188

  Fly   187 CKALLSNDEDCDVGHICTFSRL-GEGACHGDSGGPL--VSNG--YLVGLVNWGW-PCAT-GVPDV 244
            |::....|......::||.... |..||.|||||||  |.||  ..||:|:||| ||.| |.|.|
Mosquito   189 CRSAAGVDAPLGPTNVCTGPLTGGVSACSGDSGGPLYTVQNGQQVQVGIVSWGWIPCGTIGFPSV 253

  Fly   245 HASVYFYRDWIRN 257
            :..|..|.|||:|
Mosquito   254 YVGVSHYIDWIQN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 84/234 (36%)
Tryp_SPc 38..258 CDD:238113 86/237 (36%)
AgaP_AGAP009121XP_319873.4 Tryp_SPc 31..264 CDD:214473 84/234 (36%)
Tryp_SPc 32..267 CDD:238113 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.