DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP008994

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_319744.4 Gene:AgaP_AGAP008994 / 1279956 VectorBaseID:AGAP008994 Length:250 Species:Anopheles gambiae


Alignment Length:257 Identity:79/257 - (30%)
Similarity:121/257 - (47%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISLQ-----GISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVT 93
            |..|::||:|::.|..|:|:.::     |:...:.|||.:|...:|:||||| :..|:..||.|.
Mosquito     2 KSGRVVGGKASKFGEWPWQVLVRESTWLGLFTKNKCGGVLITNEYVITAAHC-QPGFLASLVAVF 65

  Fly    94 G-----TNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG 153
            |     ::...:......:|.:.:|..||.....||:|:|||..||.:|....||      ..||
Mosquito    66 GEFDISSDLETKRSVTKNVKRVIVHRQYDAATFENDLAILELENPIHYDVHIVPI------CMPG 124

  Fly   154 DE-------VILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH--------IC 203
            ||       ..:||||.....|..|..||.:.:..:.:..|:.:...     .||        :|
Mosquito   125 DEADFTGRMATVTGWGRLTYGGGVPSVLQEVQVPVIENSVCQEMFHM-----AGHNKKILPSFVC 184

  Fly   204 T-FSRLGEGACHGDSGGPLV----SNGY-LVGLVNWGWPCATG-VPDVHASVYFYRDWIRNV 258
            . ::.....:|.||||||||    ...| |||.|:.|..||.. :|.|:....||:.|:|:|
Mosquito   185 AGYANGKRDSCEGDSGGPLVLQRPDGRYELVGTVSHGIRCAAPYLPGVYMRTTFYKPWLRSV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/249 (30%)
Tryp_SPc 38..258 CDD:238113 76/251 (30%)
AgaP_AGAP008994XP_319744.4 Tryp_SPc 5..242 CDD:214473 75/248 (30%)
Tryp_SPc 6..246 CDD:238113 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.