DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG43336

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:289 Identity:76/289 - (26%)
Similarity:115/289 - (39%) Gaps:52/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVV------LLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGIS 59
            |:.||      ||.|||.:..:.: |..|:.:|.     ...|:..|..|....:|:...|....
  Fly     1 MNVVVVGLTFFLLPLLGSTQFLDM-ACGIRAHSP-----SVPRVKNGTVASLTSSPWMAFLHSTD 59

  Fly    60 GAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGR--------YFLKAI----HI 112
            |...|||::|....|||||||    |:....:|....:|::....        |.::|:    ..
  Fly    60 GRFICGGSLITNRLVLTAAHC----FLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERGFR 120

  Fly   113 HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP-----MQPGDEVILTGWGSTVLWGTS-- 170
            |.:|:...|..|||:|.|...:.:.:..:||.:.:.|     :...|.:..||||.|...|.|  
  Fly   121 HRHYNPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAK 185

  Fly   171 --PIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGP---LVSNGYLVGL 230
              .:||...:.:........:|.:|       ..|..:. ....|:||||||   |:..|.....
  Fly   186 LRTVDLARKHPEVCRRYATLSLTAN-------QFCAGNE-RSNLCNGDSGGPVGALIPYGKSKRF 242

  Fly   231 VNWGWPCATGVPDVHASVY----FYRDWI 255
            |..|....|....|..||:    .|.|||
  Fly   243 VQVGIASFTNTQCVMVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 63/245 (26%)
Tryp_SPc 38..258 CDD:238113 64/246 (26%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 63/245 (26%)
Tryp_SPc 40..271 CDD:238113 62/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.