DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG43335

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:305 Identity:82/305 - (26%)
Similarity:120/305 - (39%) Gaps:76/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAVVLLILLGLSGLVSITAIRIK----GNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH 62
            ||..|:|:.....|......|:.    |..|...|:: .|||||..||....|:...|.. ...:
  Fly     3 SAAFLVIISVCQWLCRFGESRLLEPNCGIRTMPSFHR-TRIIGGSDAEITSHPWMAYLYN-EFHY 65

  Fly    63 SCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGG------------------RYFLKA 109
            .|.|.:|...||||||||:|.:  ..|.|..|.:...:..|                  :||..:
  Fly    66 FCAGTLITNQFVLTAAHCIEAS--KNLTVRLGGSGLTRSDGSMCQITAEDYSVSMAIKHKYFTPS 128

  Fly   110 IHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP-----MQPGDEVILTGWGSTVLWGT 169
            |          |.||||::.|...:.:.:..:||.:.|.|     ::.|..::.||||       
  Fly   129 I----------MLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLEDGMTLMATGWG------- 176

  Fly   170 SPIDLQVLYLQYVPH--RECKALLSNDEDC----DV----GHICTFSRLGEGACHGDSGGPL--V 222
                  :...:..||  :|....:.|...|    ||    |.||...: ....|.|||||||  |
  Fly   177 ------LADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAGDK-ETNTCLGDSGGPLGGV 234

  Fly   223 SNGY------LVGLVNWG-WPCATGVPDVHASVYFYRDWIRNVMS 260
            .|.|      ..|:.::| ..|.:  |.::..:..|..||..|:|
  Fly   235 VNYYGDLRFVQYGITSFGDIECRS--PSIYTDLSTYSGWINMVVS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/259 (27%)
Tryp_SPc 38..258 CDD:238113 70/261 (27%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 69/259 (27%)
Tryp_SPc 42..275 CDD:238113 70/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.