DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG43110

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:266 Identity:76/266 - (28%)
Similarity:102/266 - (38%) Gaps:49/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAH-SCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ 100
            :||.|..|....|.|...:  .:..| .|||.||:|.||||.|||...   ..|.|..|....|.
  Fly    35 KIISGSNASQQSAQYMAGI--FNTTHLLCGGTIIHEDFVLTVAHCKST---QTLFVRLGAYNINH 94

  Fly   101 PGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVI-------- 157
            |..:..:.....|..|.|....|||||::|...:.::...|||.:.|      |..:        
  Fly    95 PTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHL------DATLGKQIRYYN 153

  Fly   158 LTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV 222
            ..|||.|.....|.| ||.:::.......|...|....  |...||..:..|: .|.|||||||:
  Fly   154 AFGWGRTRNAEQSDI-LQRIFVNRTNPMICHLYLGMSP--DPKQICATTDQGD-TCAGDSGGPLI 214

  Fly   223 SN--------GYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVMSGN----------------S 263
            |.        ....|:.::|.....|| .::..|..|..||.|::...                |
  Fly   215 SKITYQGKNFDTQFGITSYGTRECNGV-GLYTDVSQYSGWIANIVRSKQDRSVVSRRSNGMFLYS 278

  Fly   264 KCTGFS 269
            .|||.|
  Fly   279 DCTGDS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/234 (29%)
Tryp_SPc 38..258 CDD:238113 70/236 (30%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 68/234 (29%)
Tryp_SPc 36..257 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.