DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG43124

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:234 Identity:47/234 - (20%)
Similarity:86/234 - (36%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV-ENAFIPWLVVVTGTNKYN 99
            :||.|     ..:||:...:...|.. .|.||:||..:|||||.|. ||   ..|.|..|:..::
  Fly    32 ERING-----SSYAPWLAEILSDSKV-ICAGALINNLYVLTAASCFKEN---EKLTVRLGSGYFD 87

  Fly   100 QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG----DEVILTG 160
            :....:.:...:....:......|::.:..|...:.:....:|:.:...|...|    .|:|.. 
  Fly    88 KSYENFRVTKAYFWMTHFPANNTNNLCIFRLQTEVEFKTHIRPMCITKSPKSLGLATTFEIINE- 151

  Fly   161 WGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGP---LV 222
              ...:|         .:.:.:....||.:...:|              |......:|.|   .:
  Fly   152 --KPKMW---------YFCKNIKGLFCKYVFGENE--------------EKWQSKPTGSPWTETI 191

  Fly   223 SNGYLVGLVNWG---WPCATGVPDVHASVYFYRDWIRNV 258
            |||...|||.:|   :.......:|:.:|..:.:||..:
  Fly   192 SNGPFKGLVRYGILSYRDNKTYDEVYINVMSHINWIAQI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 45/228 (20%)
Tryp_SPc 38..258 CDD:238113 46/230 (20%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.