DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG43125

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:297 Identity:67/297 - (22%)
Similarity:107/297 - (36%) Gaps:96/297 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ-GISGAHSC 64
            |||.:.|.:..|......:|:.::.|.             |:::....||:.:.:: .:|...:|
  Fly     1 MSATLRLAVFALLLFYQGSALFLEQNC-------------GKSSVFSPAPWLVKIRPELSSNITC 52

  Fly    65 GGAIINETFVLTAAHCV--ENAFIPWLVVVTGTNKYN---QPGGRYFLKAIHIHCNYDNPEMHND 124
            .|.:|||.||||||.|:  :...|..|..:.||.:.:   |....|..:|: ||.:|.:.....:
  Fly    53 TGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARAL-IHRSYSSESHQYN 116

  Fly   125 IALLELVEPIAWDERTQPI-------PLPLVP--------------------------------- 149
            ||||.|...:.:.:..|||       .:|..|                                 
  Fly   117 IALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGV 181

  Fly   150 MQPGDEVILTGWGSTVLWG-TSPIDLQVLYLQY--VPHRECKALLSNDEDCDVGHICTFSRLGEG 211
            .:|..:|||......|.|. |..|:...|:.||  :.||..::  ..|...||            
  Fly   182 REPRPDVILPPQPIAVGWPLTKQINESALFHQYGILSHRNSES--KKDVYTDV------------ 232

  Fly   212 ACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASV 248
                            :..|||..|.|.   |||.::
  Fly   233 ----------------MAYVNWITPLAL---DVHITM 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 60/261 (23%)
Tryp_SPc 38..258 CDD:238113 60/260 (23%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.