DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP008861

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_319603.2 Gene:AgaP_AGAP008861 / 1279828 VectorBaseID:AGAP008861 Length:259 Species:Anopheles gambiae


Alignment Length:266 Identity:88/266 - (33%)
Similarity:131/266 - (49%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH-SCGG 66
            |:|:.:....||.|:..              :..:|:||...:...|||||||:  .|.| ||||
Mosquito    10 AMVVAVATVASGFVAPA--------------RRAQIVGGFPIDISEAPYQISLR--EGGHPSCGG 58

  Fly    67 AIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGG--RYFLKAIHIHCNYDNPEMHNDIALLE 129
            :||:..::||||||:|......:.:..|:. |...||  |...:.: :|..:|......||||:|
Mosquito    59 SIISPDWILTAAHCLEGVSADQVSIRAGST-YKMHGGVLRNVARVV-LHPAWDPVTNEGDIALME 121

  Fly   130 LVEPIAWDERTQ-PIPLPLV----PMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKA 189
            |..|:..|..|. .|.:|..    |:: |.:.:::|||.|:....|.:.|:..:|..|....|:.
Mosquito   122 LESPLPLDGDTMASIEMPEQDEEDPVE-GSKALVSGWGKTLNRFHSALILRATFLPIVHRDNCQK 185

  Fly   190 LLSNDEDCDVGHICT-FSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYR 252
            ............:|. |...|..:|.||||||||.:..|||:|::...|| .|:|.|:|.|...|
Mosquito   186 AYRRTHTISEMMLCAGFFEGGHDSCQGDSGGPLVVDDVLVGVVSFAIGCARPGLPGVNARVSAVR 250

  Fly   253 DWIRNV 258
            ||||.|
Mosquito   251 DWIREV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/227 (35%)
Tryp_SPc 38..258 CDD:238113 82/229 (36%)
AgaP_AGAP008861XP_319603.2 Tryp_SPc 31..256 CDD:238113 82/229 (36%)
Tryp_SPc 31..253 CDD:214473 79/226 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.