DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP009966

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_319102.4 Gene:AgaP_AGAP009966 / 1279386 VectorBaseID:AGAP009966 Length:288 Species:Anopheles gambiae


Alignment Length:265 Identity:87/265 - (32%)
Similarity:128/265 - (48%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLSGLVSITAIRIKGNSTDGRFY---KDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIIN 70
            |..::.|||.|.:.:.|.|.....|   ..:||:||...:....|||:||:  .|.|.||.:||:
Mosquito    14 LSSVTVLVSFTIVSVVGCSRSAENYDHTNGERIVGGVPVDIRDYPYQVSLR--RGRHFCGESIID 76

  Fly    71 ETFVLTAAHCVE--NAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEP 133
            ..::||||||..  ||...|:.|  |::..|..|....::.| :|....|.....|.:||.|.:|
Mosquito    77 SQWILTAAHCTRTINARNLWIHV--GSSHVNDGGESVRVRRI-LHHPKQNSWSDYDFSLLHLDQP 138

  Fly   134 IAWDERTQPIPL-------PLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALL 191
            :...|..|||||       |...:..|....::|||:|.....|.:.|:...:....|::|..:.
Mosquito   139 LNLSESVQPIPLRKPSASEPTGELSDGTLCKVSGWGNTHNPDESALVLRAATVPLTNHQQCSEVY 203

  Fly   192 SNDEDCDVGHICT-FSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDW 254
            ..........||. :...|:.:|.||||||||.:|.|.|:|:||..|| .|.|.|:|.|....:|
Mosquito   204 EGIGSVTESMICAGYDEGGKDSCQGDSGGPLVCDGQLTGVVSWGKGCAEPGYPGVYAKVSTAYEW 268

  Fly   255 IRNVM 259
            |...:
Mosquito   269 IEQTV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/228 (34%)
Tryp_SPc 38..258 CDD:238113 78/230 (34%)
AgaP_AGAP009966XP_319102.4 Tryp_SPc 45..269 CDD:214473 77/228 (34%)
Tryp_SPc 46..272 CDD:238113 78/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.