DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP003977

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_318428.5 Gene:AgaP_AGAP003977 / 1278796 VectorBaseID:AGAP003977 Length:339 Species:Anopheles gambiae


Alignment Length:224 Identity:57/224 - (25%)
Similarity:85/224 - (37%) Gaps:84/224 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITA------IRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISG-- 60
            |.||:.|.|:.:.:.:|      :|...|.|   .|.|..|      |.|..|:...:...||  
Mosquito    23 VPLLLTLFLAAVPTASAHQCFCGVRRAQNET---IYPDVPI------EPGEWPWHTLIYYWSGSR 78

  Fly    61 ----AHSCGGAIINETFVLTAAHCV------ENAFIP--WLVV---VTGTNKYNQPGGRYFLKAI 110
                |..|.||:|:|.|||.||||:      :...:|  .|||   |....:.|:...|:.::.:
Mosquito    79 LDPPAKICEGALIDERFVLAAAHCLTVRGSSDGELLPSDQLVVHVGVVSVQQDNERSRRFQVRNV 143

  Fly   111 HIHCNYDNPEMHNDIALLELV--EP---------------------------------IAWDERT 140
            .:       |..:|:||:||.  ||                                 :|.....
Mosquito   144 TV-------EDESDLALIELQLGEPRTAVPKLMPDSSASSDEDGSGGGVDVSENLLPVVADSGGW 201

  Fly   141 QPIPLPLVPMQPGDEVILTGWGSTVLWGT 169
            :|||:.||     |.:.|     |.|:||
Mosquito   202 KPIPVCLV-----DALDL-----TTLYGT 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 46/185 (25%)
Tryp_SPc 38..258 CDD:238113 46/184 (25%)
AgaP_AGAP003977XP_318428.5 Tryp_SPc 59..>157 CDD:304450 31/110 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.