DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP003971

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_318423.5 Gene:AgaP_AGAP003971 / 1278791 VectorBaseID:AGAP003971 Length:263 Species:Anopheles gambiae


Alignment Length:258 Identity:77/258 - (29%)
Similarity:124/258 - (48%) Gaps:13/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVVLLILLGLSGLVSI-TAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGG 66
            |.||.::..:.|.|:: .|:..:.|.:       .||.||:.|.||..|:|::|.. .|...|||
Mosquito     8 APVLGLVAAVLGFVTVAAALPQQANFS-------PRIAGGEDAADGQFPFQVALIN-EGLVYCGG 64

  Fly    67 AIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELV 131
            .::|..::||||.|:....:..:.:..|:......|.....:...||.:::.....|||||:.:.
Mosquito    65 TVVNRRWILTAAACITGKALSDVQLFVGSADRLTGGRNVTAERFVIHPDFNAQTYANDIALVRMA 129

  Fly   132 EPIAW-DERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTS-PIDLQVLYLQYVPHRECKALLSND 194
            |.:|: ....|||.|.....:......::|||...:.... |..||.:....:...:|.......
Mosquito   130 ESLAFTGNELQPIRLATDFFETATNATVSGWGRFAISNNQLPNRLQFIRTDVIGSEDCAEQFEEP 194

  Fly   195 EDCDVGH--ICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWI 255
            ....:..  |||.::..:|.|.||:|||||.:|.|||:.:|..||.||:|||:..|..:|.||
Mosquito   195 YRSRISDRTICTSNQANQGVCLGDAGGPLVLDGELVGVQSWSIPCGTGLPDVYERVSHHRAWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/221 (31%)
Tryp_SPc 38..258 CDD:238113 69/222 (31%)
AgaP_AGAP003971XP_318423.5 Tryp_SPc 36..257 CDD:214473 68/221 (31%)
Tryp_SPc 37..257 CDD:238113 67/220 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.