DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP004770

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_318046.3 Gene:AgaP_AGAP004770 / 1278456 VectorBaseID:AGAP004770 Length:259 Species:Anopheles gambiae


Alignment Length:238 Identity:80/238 - (33%)
Similarity:118/238 - (49%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVE---NAFIPWLVVVTGTNK 97
            |||:||...:.|.||:|.|:|. .|.|.|||:||::.:||:|.||..   |:    |.|...:..
Mosquito    29 QRIVGGHEIDIGAAPFQASVQS-HGVHVCGGSIIHQQWVLSAGHCSSKEPNS----LSVRVASIH 88

  Fly    98 YNQPGGRYFLKAIHIHCNYDNPEMHN-DIALLELVEPIAWDERTQPIPLPLVP--MQPGDEVILT 159
            :||.|....::....|..||...:.: |::||.|.:.:.:....|.|.||:..  .|.|...:::
Mosquito    89 HNQGGQIVNVEESIRHPLYDEQLIIDYDVSLLRLEQCLTFSPNVQAIRLPMQDEFFQDGTVCVVS 153

  Fly   160 GWGSTVLWGTSPID----LQVLYLQYVPHRECK-ALLSNDEDCDVGHICT--FSRLGEGACHGDS 217
            |||:|    .:|::    |:...:..|.|..|: |.:|.........||.  ||. |..||.|||
Mosquito   154 GWGAT----QNPVESSDRLRATDVPLVNHAVCQTAYISAAATITDRMICAGYFSG-GRDACQGDS 213

  Fly   218 GGPLVSNGYLVGLVNW-GWPCA-TGVPDVHASVYFYRDWIRNV 258
            ||||.....|:|:|:| ...|| ...|.|::.|...|.||..|
Mosquito   214 GGPLYYENTLIGVVSWRTGDCAEVNFPGVYSRVASVRAWIYEV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/232 (33%)
Tryp_SPc 38..258 CDD:238113 77/234 (33%)
AgaP_AGAP004770XP_318046.3 Tryp_SPc 30..253 CDD:214473 76/232 (33%)
Tryp_SPc 31..256 CDD:238113 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.