DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP011477

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_317829.4 Gene:AgaP_AGAP011477 / 1278364 VectorBaseID:AGAP011477 Length:276 Species:Anopheles gambiae


Alignment Length:270 Identity:97/270 - (35%)
Similarity:134/270 - (49%) Gaps:23/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIR---IKGNSTDGRF--YKDQRIIGGQAAEDGFAPYQISLQGISG 60
            |.::|.|.:..:| |||...:|   ||..|...::  ....|::||........|||:||:.:. 
Mosquito    11 MKSLVALCVCAMS-LVSHHTVRSSPIKRTSPICKYGLINMARVVGGSDTTIEAHPYQVSLRRLH- 73

  Fly    61 AHSCGGAIINETFVLTAAHCVENAFIPWLV-----VVTGTNKYNQPGGRYFLKAIHIHCNYDNPE 120
            .|||||||:|...:|||||||:   .|.||     |..|:...|:.|....:..||.|.:|::..
Mosquito    74 KHSCGGAILNTNTILTAAHCVD---YPELVPSDFEVRAGSTFRNEGGQLITVAQIHTHPSYNDWT 135

  Fly   121 MHNDIALLELVEPIAWDERTQPIPLP----LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQY 181
            :..||::|:||..:......|||.||    .:|  .|..|.|.||||....|.|...||.:.|..
Mosquito   136 LEWDISVLKLVSSLQLSPTVQPISLPDRGLTIP--DGTSVSLAGWGSLYYQGPSTNHLQHVMLPI 198

  Fly   182 VPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVH 245
            |.:..|.....|.......|||. ...|:.||.||||||||....:||:|:||:.|| ...|.|:
Mosquito   199 VSNSRCGMAYKNFAPILPFHICA-GHKGKDACQGDSGGPLVYQSRVVGIVSWGYGCAFENYPSVY 262

  Fly   246 ASVYFYRDWI 255
            ..|..:.|:|
Mosquito   263 TRVSEFLDFI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 85/227 (37%)
Tryp_SPc 38..258 CDD:238113 85/228 (37%)
AgaP_AGAP011477XP_317829.4 Tryp_SPc 51..272 CDD:214473 85/227 (37%)
Tryp_SPc 52..272 CDD:238113 84/226 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.