DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and TRY5_ANOGA

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_317174.2 Gene:TRY5_ANOGA / 1277691 VectorBaseID:AGAP008291 Length:274 Species:Anopheles gambiae


Alignment Length:231 Identity:85/231 - (36%)
Similarity:119/231 - (51%) Gaps:17/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ 100
            :||:||.......|||||||| ....|:|||:|::..::||||||:.:.......|..|::|:..
Mosquito    46 KRIVGGFVINISDAPYQISLQ-YDDDHNCGGSILSSKWILTAAHCINDNAPSKPTVRVGSSKHAS 109

  Fly   101 PGGRYFLKAIHIHCNYDNPEMHN-----DIALLELVEPIAWDERTQPIPLPL--VPMQPGDEVIL 158
            .|....:..|..|      .||.     |||||||...:.:.|:.|||.||.  .|::.|...|:
Mosquito   110 GGTVIRVARIVPH------PMHGSKNNYDIALLELKNELTFSEKVQPIALPEQDEPIEEGTMGIV 168

  Fly   159 TGWGSTVLWGTSPIDLQVLYLQYVPHREC-KALLSNDEDCDVGHICT-FSRLGEGACHGDSGGPL 221
            :|||.|:....|...|:...:..|..:|| ||..|..........|. :.:.|:..|..|||||.
Mosquito   169 SGWGLTLSEADSNDVLRATNVPTVNQQECNKAYQSRYGGITDQMFCAGYKQGGQDTCRQDSGGPF 233

  Fly   222 VSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIR 256
            |:.|.|:|:::||..|| .|.|.|:|.|...|||||
Mosquito   234 VAKGKLIGVISWGHECALAGYPGVYARVASVRDWIR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 82/227 (36%)
Tryp_SPc 38..258 CDD:238113 84/229 (37%)
TRY5_ANOGAXP_317174.2 Tryp_SPc 47..268 CDD:214473 82/227 (36%)
Tryp_SPc 48..271 CDD:238113 84/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.