DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and TRY1_ANOGA

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_317170.2 Gene:TRY1_ANOGA / 1277688 VectorBaseID:AGAP008296 Length:274 Species:Anopheles gambiae


Alignment Length:230 Identity:82/230 - (35%)
Similarity:126/230 - (54%) Gaps:5/230 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGT 95
            |:...|||:||...:...||||:||| .:..|:|||::::..:|||||||...|....|.|..||
Mosquito    41 RYAVGQRIVGGFEIDVSDAPYQVSLQ-YNKRHNCGGSVLSSKWVLTAAHCTAGASPSSLTVRLGT 104

  Fly    96 NKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL--VPMQPGDEVIL 158
            :::...|....:..:..|..||:..:..|.:||||.:.:.:.:..||:.||.  ..::.|....:
Mosquito   105 SRHASGGTVVRVARVVQHPKYDSSSIDFDYSLLELEDELTFSDSVQPVGLPKQDETVKDGTMTTV 169

  Fly   159 TGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGACHGDSGGPLV 222
            :|||:|.....|...|:...:..|..:||....|.........:|. :.:.|:.||.||||||||
Mosquito   170 SGWGNTQSAAESNAVLRAANVPTVNQKECNKAYSEFGGVTDRMLCAGYQQGGKDACQGDSGGPLV 234

  Fly   223 SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIR 256
            ::|.|||:|:||:.|| .|.|.|::.|...|||:|
Mosquito   235 ADGKLVGVVSWGYGCAQAGYPGVYSRVAVVRDWVR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/221 (35%)
Tryp_SPc 38..258 CDD:238113 79/223 (35%)
TRY1_ANOGAXP_317170.2 Tryp_SPc 47..268 CDD:214473 78/221 (35%)
Tryp_SPc 48..271 CDD:238113 79/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.