DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP006674

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_316711.4 Gene:AgaP_AGAP006674 / 1277264 VectorBaseID:AGAP006674 Length:306 Species:Anopheles gambiae


Alignment Length:261 Identity:81/261 - (31%)
Similarity:114/261 - (43%) Gaps:63/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGI--SGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99
            ||:.||.|..|..|||::|...  :|...||..||...|:||||||           |.|.|...
Mosquito    59 RIVNGQQATPGQFPYQVALLSNFGTGTGLCGATIITNNFLLTAAHC-----------VVGGNGQV 112

  Fly   100 QPGGRYFLKA-------------------IHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPL 145
            ..||...|.|                   |.:|.:|:...:.||||.:.|..|..::.|.|||.|
Mosquito   113 AIGGTAILGAHDRTVVEPTQQRIAFAQSGIFVHPSYNPSTIRNDIATVRLNTPATFNARVQPIDL 177

  Fly   146 PL---VPMQPGDEVILTGWGST--VLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCD------- 198
            |.   .....|.|...:|:|.|  ....|||:   |::.:       ..:|||.: |:       
Mosquito   178 PARSDARTFAGVEGTASGFGRTSDASTATSPV---VMFTR-------NPILSNAQ-CNSFWSTAV 231

  Fly   199 --VGHICTFSRLGEGACHGDSGGPL-VSNG---YLVGLVNW--GWPCATGVPDVHASVYFYRDWI 255
              ..::|..:..|...|:||||||| |.:|   ..||:.::  ...||:|.|.|...:.|:||||
Mosquito   232 VQAQNVCLDATGGRSPCNGDSGGPLAVQDGGRSLEVGIASFVSAAGCASGAPSVWVRISFFRDWI 296

  Fly   256 R 256
            :
Mosquito   297 Q 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/258 (31%)
Tryp_SPc 38..258 CDD:238113 80/260 (31%)
AgaP_AGAP006674XP_316711.4 Tryp_SPc 59..296 CDD:214473 79/258 (31%)
Tryp_SPc 60..299 CDD:238113 80/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.