DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP006672

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_316708.4 Gene:AgaP_AGAP006672 / 1277262 VectorBaseID:AGAP006672 Length:327 Species:Anopheles gambiae


Alignment Length:258 Identity:77/258 - (29%)
Similarity:116/258 - (44%) Gaps:56/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHS---CGGAIINETFVLTAAHC---------------VEN 83
            ::.||..|::...|:.:|:..|....|   |||:|:.:.|:||||||               ::.
Mosquito    79 KVAGGTVAKNDQFPHLVSIILIFADGSDTLCGGSILADRFILTAAHCLYGMQEATIVPGQSVIQI 143

  Fly    84 AFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP-- 146
            .|.|.:|.|.     .:|....      :|..||..::.|||||:.|.:|:.:..|.|||.||  
Mosquito   144 PFPPDIVTVA-----IKPADTI------LHPGYDPVDILNDIALIRLPQPLTFSARVQPIRLPSW 197

  Fly   147 ---LVPMQPGDEVILTGWGS------TVLWGTSPIDLQVLYLQYVPHRECKAL---LSNDEDCDV 199
               .|.: .|.:.|::|||:      ..|.....:||:......||:..|..:   :..|:    
Mosquito   198 TNSYVDL-TGYDSIVSGWGAQSNDDYAELVDEMRLDLRFATNTIVPNAVCHRVYGSIIRDQ---- 257

  Fly   200 GHICTFSRLGEGACHGDSGGPLV--SNGY---LVGLVNWG--WPCATGVPDVHASVYFYRDWI 255
             .||.....|...|.|||||||.  .:|.   .||:|::|  ..|..|||.|:..|..|.:||
Mosquito   258 -QICVAGEGGRNPCQGDSGGPLTVKFDGQRLTQVGIVSYGSVLGCENGVPGVYTRVSSYVEWI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/256 (29%)
Tryp_SPc 38..258 CDD:238113 77/257 (30%)
AgaP_AGAP006672XP_316708.4 Tryp_SPc 79..319 CDD:214473 75/256 (29%)
Tryp_SPc 80..319 CDD:238113 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.