DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP006487

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_316522.4 Gene:AgaP_AGAP006487 / 1277089 VectorBaseID:AGAP006487 Length:281 Species:Anopheles gambiae


Alignment Length:244 Identity:64/244 - (26%)
Similarity:102/244 - (41%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVEN--AFIP----WLVVVTGT 95
            |:.||.|...|..|..:.::......:|.|.::|...|||||.||.|  .|:.    ||.|:.|.
Mosquito    28 RVTGGTATLLGQYPSAVIIETPYIPQNCMGTVVNRQHVLTAASCVMNPTTFVMINPFWLRVIAGD 92

  Fly    96 NKYNQPGGRYFLKAI---HIHCNYDNPEMHNDIALLELVEPIAWDERT-QPIPLPLVPMQPGDEV 156
            ........|..::.:   ::|.||:.....|::|:|.:..|......| :|..|....:....:.
Mosquito    93 INIVPVSTRREVRQVIRSYVHPNYNRLTDGNNLAVLRVDVPFPEFHNTIEPALLNARILADNTQC 157

  Fly   157 ILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH----------IC--TFSRLG 209
            :..|||:|    .:.:...|...|:|..:...|.:|    |:..:          ||  ..::..
Mosquito   158 VFAGWGAT----QNQVTAVVRPNQFVVTQPILATVS----CNAANVHNNRVQQTMICAGALAQSQ 214

  Fly   210 EGACHGDSGGPLVSNGYLVGLVNWGWPCATGV---PDVHASVYFYRDWI 255
            ...|.|:.||.|..||.|.|::.:|..|  ||   |.|:..|..|..||
Mosquito   215 NAVCRGNMGGGLYCNGRLTGVLAFGLGC--GVANQPGVYMDVRQYTQWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 62/242 (26%)
Tryp_SPc 38..258 CDD:238113 63/243 (26%)
AgaP_AGAP006487XP_316522.4 Tryp_SPc 28..261 CDD:214473 62/242 (26%)
Tryp_SPc 29..264 CDD:238113 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.