DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and SP24D_ANOGA

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_316450.1 Gene:SP24D_ANOGA / 1277027 VectorBaseID:AGAP006416 Length:271 Species:Anopheles gambiae


Alignment Length:280 Identity:90/280 - (32%)
Similarity:138/280 - (49%) Gaps:43/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLSGLVSITAIR---------IKGNSTDGR-FYKDQRIIGGQAAEDGFAPYQIS-LQGI 58
            |.|.|..|:.|..::.:|         :.|.|...| |::..||:||..|.:|..|:|:: |:| 
Mosquito     7 VPLALAALAYLALVSGVRFHLSEQNDVLPGGSQARRPFFQGARIVGGSVASEGQFPHQVALLRG- 70

  Fly    59 SGAHSCGGAIINETFVLTAAHCVENA--FIP--WLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNP 119
             .|.:|||::|...:||||||||.|.  .:|  .:|||.|:...:. |.|..:..:..|..|.| 
Mosquito    71 -NALTCGGSLIESRWVLTAAHCVYNGALVVPASSIVVVAGSVSLSN-GVRRAVARVIPHERYGN- 132

  Fly   120 EMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPH 184
             ..||:|||:|...:......:||.|....:..|.||:::|||.  ::...|:...:.|      
Mosquito   133 -FKNDVALLQLQLSLPSSAYIRPIALRTTSVPAGSEVVISGWGR--MYQGGPVSNMLRY------ 188

  Fly   185 RECKALLSNDEDC------DVGHICTFSRLGEGACHGDSGGPLVSNGYLVG----LVNWGWPCAT 239
              .:|.:..|:.|      ..|.||..|.:..|||:||||||.:.|..|||    ::|:   |.:
Mosquito   189 --NRATVVADQQCRMATGISTGLICFTSPVNNGACNGDSGGPAILNNQLVGVANFIINY---CGS 248

  Fly   240 GVPDVHASVYFYRDWIRNVM 259
            ..||.:|.|..:..||:..|
Mosquito   249 ASPDGYARVSDFVTWIQTTM 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/232 (33%)
Tryp_SPc 38..258 CDD:238113 78/234 (33%)
SP24D_ANOGAXP_316450.1 Tryp_SPc 49..264 CDD:214473 77/232 (33%)
Tryp_SPc 50..267 CDD:238113 78/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.