DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005707

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_315716.4 Gene:AgaP_AGAP005707 / 1276376 VectorBaseID:AGAP005707 Length:299 Species:Anopheles gambiae


Alignment Length:302 Identity:83/302 - (27%)
Similarity:123/302 - (40%) Gaps:61/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLG----------------LSGLVSITAIRIK---GNSTDGRFYKDQRIIGGQAAED 46
            ::|..||:|||                :..|....|||.|   ...||.: .:..||..||.|..
Mosquito     7 LAATALLLLLGQVSSTPVDPRSVDWSVVRTLHQTDAIRAKQGLAPLTDDQ-VRSSRISDGQIATA 70

  Fly    47 GFAPYQISLQGISGAHS---CGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLK 108
            ...|:.:.:. |||:.|   |.|.:|:..||||||.|:..:  ..|.::.|.:...:......:.
Mosquito    71 TQFPWAVGVL-ISGSSSHSFCSGVLISPRFVLTAAVCISGS--NTLTILLGASDMTRVEEFIGVS 132

  Fly   109 AIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGD--------EVILTGWGSTV 165
            .|..|.||.:....:|||:|.|..|.......:||.||    :..|        .....|||:|.
Mosquito   133 NILSHPNYSSFFNRDDIAILTLSSPAPIRNTIRPIDLP----RWSDVGNNFNNWAATTAGWGNTG 193

  Fly   166 LWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG-------HICTFSRLGEGACHGDSGGPLV- 222
            .....||.:..|      |....::.||.. |.:.       ||||.:..| |.|:||.|||:. 
Mosquito   194 RRENEPIPIPNL------HFAVDSVNSNFV-CGLSHTFIRDTHICTSTDNG-GPCNGDEGGPVTV 250

  Fly   223 ---SNGYLVGLVNWGWP----CATGVPDVHASVYFYRDWIRN 257
               ...:|||:.::.:.    |..|...||..:..|..||::
Mosquito   251 TESGRTFLVGIHSFHYSGLFGCDRGRSAVHTRITEYLGWIQD 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/243 (28%)
Tryp_SPc 38..258 CDD:238113 69/246 (28%)
AgaP_AGAP005707XP_315716.4 Tryp_SPc 61..290 CDD:214473 68/243 (28%)
Tryp_SPc 62..293 CDD:238113 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.