DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005691

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_315702.4 Gene:AgaP_AGAP005691 / 1276364 VectorBaseID:AGAP005691 Length:301 Species:Anopheles gambiae


Alignment Length:257 Identity:77/257 - (29%)
Similarity:116/257 - (45%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDQRIIGGQAAEDGFAPYQISL--QGISGAHSCGGAIINETFVLTAAHCV---ENAFIPWLVVVT 93
            :..||..||.|..|..|:||:|  :..:....|||:|:....:|||||||   .:......|.:.
Mosquito    52 RTNRITNGQEATPGQFPHQIALLSEYATSTGLCGGSILTRNTILTAAHCVVSGPSTLASGGVAIM 116

  Fly    94 GTNKYN-----QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP---LVPM 150
            |.:..|     |...|:....|.:|..|:...:.||||.:.|..|:.:..|.|||.||   ....
Mosquito   117 GAHNRNVQESTQQRIRFATSGIRVHPQYNLASIRNDIATVRLNSPMTFTTRIQPIRLPGRSDTRQ 181

  Fly   151 QPGDEVILTGWGST----------VLWGTSPIDLQVLYLQYVPHRECKA-----LLSNDEDCDVG 200
            ..|....::|:|.|          |.:.|:|:         :.:.:|.|     ::.|.      
Mosquito   182 FGGFTGTVSGFGRTSDASTATSAVVRFTTNPV---------MTNADCVARWGTTMVQNQ------ 231

  Fly   201 HICTFSRLGEGACHGDSGGPLV--SNGYL-VGLVNW----GWPCATGVPDVHASVYFYRDWI 255
            ::|.....|..||:|||||.|.  |.|.| :|:|::    |  ||.|:|.|:|.|.|:..||
Mosquito   232 NVCLSGAGGRSACNGDSGGALTVQSGGTLQIGVVSFVSVNG--CAVGMPSVYARVSFFLPWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/252 (30%)
Tryp_SPc 38..258 CDD:238113 76/253 (30%)
AgaP_AGAP005691XP_315702.4 Tryp_SPc 55..291 CDD:214473 75/252 (30%)
Tryp_SPc 56..294 CDD:238113 76/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.