DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005670

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_315687.1 Gene:AgaP_AGAP005670 / 1276350 VectorBaseID:AGAP005670 Length:300 Species:Anopheles gambiae


Alignment Length:317 Identity:85/317 - (26%)
Similarity:134/317 - (42%) Gaps:89/317 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNS---------------TDGRFYK----DQRIIGGQAAED 46
            |...|||:  ||..:.|...|.|..:.               .:.:.|:    ..||:.||.|..
Mosquito     1 MKTFVLLV--GLLAVASAEWIEIDWSQVRPIEEFDHYWERLPAEMQIYRKMLPTHRIVNGQEATP 63

  Fly    47 GFAPYQISL--QGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTG--------------- 94
            |..||||:|  :.::|...|||:::...::||||||          ||:|               
Mosquito    64 GQFPYQIALLSEFLTGTGLCGGSVLTNNYILTAAHC----------VVSGATTLARGGTAIMGAH 118

  Fly    95 ---TNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL---VPMQPG 153
               .|:.:|...|:....|..|..|....:.||||::.|..||.::.|.||..||.   .....|
Mosquito   119 NRNVNEPSQQRIRFSTGGIIRHPQYTTTNIRNDIAVVRLDAPIVFNTRVQPARLPARSDTRQFGG 183

  Fly   154 DEVILTGWG----------STVLWGTSPIDLQVLYLQYVPHREC-----KALLSNDEDCDVGHIC 203
            ....::|:|          :.|.:.::|:         :.:.:|     .||:...      ::|
Mosquito   184 FTGTVSGFGRVSDGSTATSAVVRFTSNPV---------MTNADCIARWNTALIQPQ------NVC 233

  Fly   204 TFSRLGEGACHGDSGGPL-VSNG--YLVGLVNWG--WPCATGVPDVHASVYFYRDWI 255
            .....|..||:||||||| |.:|  ..:|:|::|  ..|:.|:|.|:|.|.|:..||
Mosquito   234 LSGEGGRSACNGDSGGPLAVQDGGSLQIGIVSFGSAGGCSIGMPSVYARVSFFLSWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/260 (28%)
Tryp_SPc 38..258 CDD:238113 74/261 (28%)
AgaP_AGAP005670XP_315687.1 Tryp_SPc 54..290 CDD:214473 73/260 (28%)
Tryp_SPc 55..293 CDD:238113 74/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.