DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005664

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_315684.2 Gene:AgaP_AGAP005664 / 1276347 VectorBaseID:AGAP005664 Length:306 Species:Anopheles gambiae


Alignment Length:262 Identity:78/262 - (29%)
Similarity:119/262 - (45%) Gaps:68/262 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQG--ISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99
            |::.||.|..|..||||:|..  :.|...|||:::...:|||||||          |:.||:.. 
Mosquito    60 RVVNGQEATPGQFPYQIALLSNFLIGTGLCGGSVLTNNYVLTAAHC----------VIMGTSTV- 113

  Fly   100 QPGGRYFLKA-------------------IHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPL 145
            ..||...:.|                   |..|..|.:..:.||||::.|..||.:.:|.||..|
Mosquito   114 ALGGNAIMGAHNRDAPEPSQQIIAFTSAGISAHPGYSSANIRNDIAVVRLNSPITFTDRIQPARL 178

  Fly   146 PL---VPMQPGDEVILTGWG----------STVLWGTSPIDLQVLYLQYVPHREC----KALLSN 193
            |.   .....|....::|:|          |.|::.::|:         :.:.:|    .|:|..
Mosquito   179 PARSDTRQFGGFTGTVSGFGRTSDASQATSSVVMFTSNPV---------MTNADCIAQWNAVLIE 234

  Fly   194 DEDCDVGHICTFSRLGEGACHGDSGGPL-VSNG--YLVGLVNWGWP--CATGVPDVHASVYFYRD 253
            .:     ::|.....|..||:||||||| |.:|  ..||:|::|..  ||.|:|.|:|.|.|:.|
Mosquito   235 PQ-----NVCMSGEGGRSACNGDSGGPLAVQDGGSLQVGVVSFGSAAGCAIGMPSVYARVSFFLD 294

  Fly   254 WI 255
            :|
Mosquito   295 FI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/260 (30%)
Tryp_SPc 38..258 CDD:238113 77/261 (30%)
AgaP_AGAP005664XP_315684.2 Tryp_SPc 60..296 CDD:214473 77/260 (30%)
Tryp_SPc 61..299 CDD:238113 77/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.