DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP008649

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_314746.4 Gene:AgaP_AGAP008649 / 1275498 VectorBaseID:AGAP008649 Length:312 Species:Anopheles gambiae


Alignment Length:251 Identity:75/251 - (29%)
Similarity:117/251 - (46%) Gaps:41/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            |:|||..::....|:..:|. .....:|||::||:.::|||||||.              :.:..
Mosquito    60 RVIGGNTSDIDQYPWMAALY-YRQQFTCGGSLINDRYILTAAHCVA--------------RMDAA 109

  Fly   102 GGRYFLK----------AIH------IHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPM 150
            |...:|:          |:|      :...|.....:||:|||.|.||:...:...||.||:...
Mosquito   110 GFEVYLRRPNIVTLNPEAVHRRVARIVMNRYQELRNNNDVALLLLKEPVGVADGLVPICLPVDGS 174

  Fly   151 Q-PGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGAC 213
            . .|.|.|:||||:|.. |.....||.|.:..:.:::|:.............:|. :...|..:|
Mosquito   175 NFDGKEAIVTGWGTTES-GELSEHLQQLTVPILTNQQCRKSGYFRFQITAKMLCAGYLEGGRDSC 238

  Fly   214 HGDSGGPL-VSNG-----YLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            .||||||| ::.|     .:||:|:||..|| ...|.|:|.|..:..|||:..:||
Mosquito   239 QGDSGGPLQLAKGETDQQQIVGVVSWGNECAQRNYPGVYARVTRFVSWIRSHSAGN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 70/242 (29%)
Tryp_SPc 38..258 CDD:238113 72/244 (30%)
AgaP_AGAP008649XP_314746.4 Tryp_SPc 60..287 CDD:214473 70/242 (29%)
Tryp_SPc 61..290 CDD:238113 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.