DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005195

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_314094.4 Gene:AgaP_AGAP005195 / 1274901 VectorBaseID:AGAP005195 Length:250 Species:Anopheles gambiae


Alignment Length:265 Identity:80/265 - (30%)
Similarity:128/265 - (48%) Gaps:20/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            :|.:|.|:||.:.   |:.|..::..:.         ||||...||...||.:|:  ...:..||
Mosquito     3 LSGIVPLVLLVVH---SLEASPVEPLAP---------IIGGSNVEDKKVPYLVSI--TVNSFVCG 53

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLEL 130
            |:||.:.::|||||||:...:....|...||.:...|..|.:.....|..|......:|:.||.|
Mosquito    54 GSIIADRWILTAAHCVKRNMVKNAAVRVETNNFTASGTLYRIDRAIAHEKYFRGAFRDDVGLLRL 118

  Fly   131 VEPIAWDERTQPIPL--PLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSN 193
            ..|:.:.||.:.|.|  .:||...  .:.|.|.|.......:....|::..:.:..:.|:.:  .
Mosquito   119 RSPLKFGERVKKIELLSQIVPYNA--TLTLVGRGYISKDNKTTKITQMIKAKNIALKLCRKM--Q 179

  Fly   194 DEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNV 258
            .:....||:|||.:.|:|.|.||||||:|..|..||:|:|...|..|..|||:.:.::..||:..
Mosquito   180 PDFIYPGHLCTFVKKGKGTCSGDSGGPVVWYGRQVGIVSWSKGCGAGYFDVHSRISYFLPWIKAT 244

  Fly   259 MSGNS 263
            ::.||
Mosquito   245 IAANS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 69/219 (32%)
Tryp_SPc 38..258 CDD:238113 71/221 (32%)
AgaP_AGAP005195XP_314094.4 Tryp_SPc 28..244 CDD:238113 71/221 (32%)
Tryp_SPc 28..241 CDD:214473 69/218 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D120424at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.890

Return to query results.
Submit another query.