DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005194

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_314093.2 Gene:AgaP_AGAP005194 / 1274900 VectorBaseID:AGAP005194 Length:272 Species:Anopheles gambiae


Alignment Length:251 Identity:93/251 - (37%)
Similarity:130/251 - (51%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLV----------VV 92
            |:.|..||:..||||:||| |.|..:|.|:|:.:.::|||.|||     |.|.          ||
Mosquito    34 IVDGSDAEENAAPYQVSLQ-IDGNSTCSGSIVGDRWILTAEHCV-----PLLQFFSERSNNTRVV 92

  Fly    93 TGTNKYNQPGGRYFLKAIHIHCNYDNPE---MH--------NDIALLELVEPIAWDERTQPIPLP 146
            .|||...:.|..||:....   ||||..   :|        |||||:.|..|:.:::|.:.|...
Mosquito    93 AGTNDLKKGGTPYFIDRFF---NYDNCSTMLVHTFMFNSTPNDIALIRLTTPLKFNQRVKKIEFT 154

  Fly   147 LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEG 211
            ...:.....:.|||||. :..||||..||.:....:....|:|:. |:...:.|.||:.|:.|||
Mosquito   155 TETVPENATLTLTGWGQ-MRNGTSPAKLQTINAPSIRIDHCRAIY-NETYLNDGTICSLSKRGEG 217

  Fly   212 ACHGDSGGPLVSNGYLVGLV----NWGWPCATGVPDVHASVYFYRDWIRNVMSGNS 263
            ||.||||||:...|.|||:.    |.|  |..|.||:|.||.:|..||::.::.||
Mosquito   218 ACMGDSGGPVTWKGKLVGIFKAVHNKG--CGEGFPDIHTSVAYYYKWIKDTIANNS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 89/241 (37%)
Tryp_SPc 38..258 CDD:238113 91/244 (37%)
AgaP_AGAP005194XP_314093.2 Tryp_SPc 34..266 CDD:238113 91/244 (37%)
Tryp_SPc 34..263 CDD:214473 89/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRU4
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.