DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP004568

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_313873.5 Gene:AgaP_AGAP004568 / 1274710 VectorBaseID:AGAP004568 Length:283 Species:Anopheles gambiae


Alignment Length:272 Identity:78/272 - (28%)
Similarity:125/272 - (45%) Gaps:70/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV------------------ 81
            :.:|:||..||.|..|:.::|. .:....|||::||:.:||||||||                  
Mosquito    40 NSKIVGGHEAEIGRYPWMVALY-YNNRFICGGSLINDRYVLTAAHCVFGSDRSRFSVKFLMHDRT 103

  Fly    82 ---ENAF---IPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERT 140
               |::|   :.:::    ||        :||..:..        :.||:|||:|.||:...|..
Mosquito   104 VPKEDSFERKVSYIM----TN--------WFLNVLVF--------ITNDVALLKLSEPVPLGETI 148

  Fly   141 QPIPLPLVP---MQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECK------ALLSNDED 196
            .|:.||  |   ...|.|.|:||||. :..||.|:.||.:::..:.:.:|.      ....||..
Mosquito   149 IPVCLP--PEGNTYAGQEGIVTGWGK-LGDGTFPMKLQEVHVPILSNEQCHNQTQYFRFQINDRM 210

  Fly   197 CDVGHICTFSRLGEGACHGDSGGPL-----VSNGYLV-GLVNWGWPCA-TGVPDVHASVYFYRDW 254
            ...|    ....|:.:|.||||||:     .:|.::: |:|:||:.|| ...|.::|.|..:..|
Mosquito   211 MCAG----IPEGGKDSCQGDSGGPMHVFDTEANRFVIAGVVSWGFGCAQPRFPGIYARVNRFISW 271

  Fly   255 IRNVMSGNSKCT 266
            |.  .:....||
Mosquito   272 IN--FNTRDACT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/257 (29%)
Tryp_SPc 38..258 CDD:238113 76/259 (29%)
AgaP_AGAP004568XP_313873.5 Tryp_SPc 42..272 CDD:214473 74/257 (29%)
Tryp_SPc 43..275 CDD:238113 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.