DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP004552

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_313850.5 Gene:AgaP_AGAP004552 / 1274693 VectorBaseID:AGAP004552 Length:349 Species:Anopheles gambiae


Alignment Length:248 Identity:82/248 - (33%)
Similarity:120/248 - (48%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99
            ::||:||...||....:..:|. ......|||:::::.:|:|||||..........|..|.|..:
Mosquito   108 NERIVGGIPVEDNSFSWMAALY-YDNKFCCGGSLLSDRYVITAAHCTTKPDRGLFRVQFGINDRS 171

  Fly   100 QPGGRYFLKAI-HIHCNYDNP-EMHNDIALLELVEPIAWDERTQPIPLP-LVPMQPGDEVILTGW 161
            :|......::: .|..|:.|. ..:||||||||..|:|..:|..||.|| ...|..|...|:|||
Mosquito   172 KPIATSIERSVKRILTNWYNAFNNNNDIALLELTYPVAISDRVMPICLPQATEMYEGSRGIVTGW 236

  Fly   162 GSTVLWGTSPIDLQVLYLQYVPHRECKAL------LSNDEDCDVGHICTFSRLGEGACHGDSGGP 220
            |.|...|.....|....:..:.:|||:..      ::|...| .|::    ..|:.:|.||||||
Mosquito   237 GRTKAGGGLSGTLMQTEVPILTNRECRRAGYWAFQITNKMLC-AGYL----EGGKDSCQGDSGGP 296

  Fly   221 L-----VSNGY-LVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGNSKCT 266
            |     .||.| |||:|:||..|| ...|.|:|.|..|..||...:..:..|:
Mosquito   297 LQVLNTKSNHYELVGVVSWGRACAQKNFPGVYARVSQYLYWINRNIKDSCLCS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/233 (34%)
Tryp_SPc 38..258 CDD:238113 80/235 (34%)
AgaP_AGAP004552XP_313850.5 Tryp_SPc 110..338 CDD:214473 79/233 (34%)
Tryp_SPc 111..341 CDD:238113 80/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.