DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP002432

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_312513.5 Gene:AgaP_AGAP002432 / 1273529 VectorBaseID:AGAP002432 Length:318 Species:Anopheles gambiae


Alignment Length:265 Identity:85/265 - (32%)
Similarity:118/265 - (44%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQG--ISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGT-- 95
            ::||:.||.|..|..|||::|.|  .:|...||.:||.:.:||||||||.........|..||  
Mosquito    65 NRRIVNGQEARPGQFPYQVALLGQFNAGVGLCGASIITQRYVLTAAHCVYTGVDASAPVANGTAI 129

  Fly    96 -----NKYNQPGGR---YFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP 152
                 ....:|..:   :....:..|..||..::.||||::.|.|.|.:.:|.|||.||    ..
Mosquito   130 LGAHNRMIEEPSQQRITFSSSGVIGHPGYDLFDVRNDIAVVRLDELIVYTDRIQPIRLP----SR 190

  Fly   153 GDEVILTGWGSTV----LWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG-----------HI 202
            .|.....|...||    ::.|:...|..: |.||    ...:::| .||..|           :|
Mosquito   191 SDTRTFAGLMGTVSGYGIYSTANPALSDV-LNYV----LNPVMTN-ADCRAGWSGLEWLIEAQNI 249

  Fly   203 CTFSRLGEGACHGDSGGPLV----SNGYLVGLVNWGWP--CATGVPDVHASVYFYRDWIRNVMSG 261
            |.....|..||:.||||||.    .....||:|::|..  |..|||.|.|.|.:|.:||    ..
Mosquito   250 CQSGDGGRAACNSDSGGPLTVQDSGESLQVGVVSFGSSVGCDNGVPTVFARVTYYLEWI----EA 310

  Fly   262 NSKCT 266
            ||..|
Mosquito   311 NSDFT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/250 (32%)
Tryp_SPc 38..258 CDD:238113 81/252 (32%)
AgaP_AGAP002432XP_312513.5 Tryp_SPc 67..308 CDD:214473 80/250 (32%)
Tryp_SPc 68..311 CDD:238113 81/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.