DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP010659

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_311380.4 Gene:AgaP_AGAP010659 / 1272466 VectorBaseID:AGAP010659 Length:393 Species:Anopheles gambiae


Alignment Length:219 Identity:67/219 - (30%)
Similarity:97/219 - (44%) Gaps:8/219 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            ||:.|:.|.....||.:.|: ::.|..||.:||..|.|.|||||:.....|..:.:.|.:.....
Mosquito     8 RIVNGKNANIASYPYIVRLR-VNSAGVCGASIITYTHVFTAAHCLYKNQNPASITLYGGSTSQTS 71

  Fly   102 GG-RYFLKAIHIHCNYDNPEMHN-DIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWG-S 163
            || .:|...:.|| .|.|||.|| |..::::.......:...||.|..|.:.........||| :
Mosquito    72 GGVVFFASKVIIH-PYYNPETHNYDAGIVQIKNSFQGYKNIAPIALQDVEVPSDTTCYAAGWGYN 135

  Fly   164 TVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLV 228
            .....|||.:||...||.:..::|.|..|:  ......||.........|:||||||.|.|..|.
Mosquito   136 NYDRKTSPDNLQYATLQVISPQQCSAGWSS--YATPQFICAQQNNNGDVCNGDSGGPFVCNDKLT 198

  Fly   229 GLVNWGW-PCATGVPDVHASVYFY 251
            |..::|. .|...:|.....:..|
Mosquito   199 GATSYGGVACRGKLPSAFTKITLY 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 67/219 (31%)
Tryp_SPc 38..258 CDD:238113 66/218 (30%)
AgaP_AGAP010659XP_311380.4 Tryp_SPc 8..222 CDD:214473 66/217 (30%)
Tryp_SPc 9..222 CDD:238113 65/216 (30%)
Trypsin <239..379 CDD:278516
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.