DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP011590

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_309917.4 Gene:AgaP_AGAP011590 / 1271167 VectorBaseID:AGAP011590 Length:354 Species:Anopheles gambiae


Alignment Length:272 Identity:86/272 - (31%)
Similarity:119/272 - (43%) Gaps:61/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DGRFYKDQRIIGGQAAEDGFAPYQISLQGI-SGAHSCGGAIINETFVLTAAHCVENAFIPWLVVV 92
            ||:.....|||||..|..|..|..:|||.: :.||.|||.:|....|:||||||.|        |
Mosquito    84 DGKVLWFPRIIGGTLATVGEFPAMVSLQLVRNSAHVCGGTLITMGHVMTAAHCVTN--------V 140

  Fly    93 TG----TNKYNQPG-GRYFLKA-------------IHIHCNYDNPEMHNDIALLELVEPIAWDE- 138
            .|    .::|...| ..|.|:|             ||:|..||.....||:|:|.:.......: 
Mosquito   141 RGDAQPASQYQVMGDDLYVLQAMASPLRQTRRVSSIHVHPKYDASLFINDVAILRVASEFRKTDT 205

  Fly   139 -----RTQPIPLPLVPMQPGDEVILTGWGST--VLWGTSPIDLQVLYLQYVPHRECKALLSNDED 196
                 |.|..|:      .||...|.|||.|  ....|||..|::           ..::|:...
Mosquito   206 FFPGKRIQKAPI------YGDRCSLAGWGVTDEQSRATSPNLLRI-----------NVVISDFGT 253

  Fly   197 CDV--GHICTFSRL-----GEGACHGDSGGPLV-SNGYLVGLVNWGWPCA-TGVPDVHASVYFYR 252
            |:.  |::.|...|     |..||.|||||.|: :.|.:.|:|::|..|| .|||.|:..|..|.
Mosquito   254 CNAVFGNLLTLGMLCAEAPGRDACQGDSGGALLCAGGRVAGIVSFGDGCAKPGVPGVYTDVAHYE 318

  Fly   253 DWIRNVMSGNSK 264
            .||..|:..:.:
Mosquito   319 KWINGVLRNSGQ 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 81/253 (32%)
Tryp_SPc 38..258 CDD:238113 82/255 (32%)
AgaP_AGAP011590XP_309917.4 Tryp_SPc 92..321 CDD:214473 81/253 (32%)
Tryp_SPc 93..322 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.