DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005303

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_309096.4 Gene:AgaP_AGAP005303 / 1270372 VectorBaseID:AGAP005303 Length:371 Species:Anopheles gambiae


Alignment Length:281 Identity:75/281 - (26%)
Similarity:126/281 - (44%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LILLGLSGLVSITAIRIKGNSTDGRFYKDQRII-GGQAAEDGFAPYQISL-QGISG--AHSCGGA 67
            |:|..|..:||.|..:....:...|..|.:.:| .|..|:.|..|:.::: ...||  .::|||:
Mosquito    10 LLLCLLCVVVSQTHAQNNHLTCGKRKVKSEYLIQNGIDAKAGHWPWHVAIFHATSGRMGYACGGS 74

  Fly    68 IINETFVLTAAHCVEN----AFIPWLVVVTG------TNKYNQPGGRYFLKAIHIHCNYDNPEMH 122
            ||:|:.:|||:|||..    ..:..:.|..|      |:.|.|   .:.::.|.:|..:....:.
Mosquito    75 IIDESTILTASHCVYTKSGVLSVSRVSVDVGRIHLNETSNYTQ---THAVRQIIVHPRFSQHSII 136

  Fly   123 NDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDL--QVLYLQYVPHR 185
            |||||::|...|...:..||:  .|..|.....:|:...|:.|.:|.:..|:  ..|....|..:
Mosquito   137 NDIALIKLRTNITMSKYVQPV--CLWTMDSNQTLIVGRSGTIVGFGLNERDVVSDQLKQALVGVQ 199

  Fly   186 ECKALLSNDEDCDVGHI-----CTFSRLGEGACHGDSGGPLV----SNGYLVGLVNW------GW 235
            :....:::|.|....|:     |...:.|..||:|||||.:.    ...|:.|||::      ..
Mosquito   200 DGLTCIASDRDVFGTHLTTDMFCGMGQNGASACNGDSGGGMFFEVGGKWYVRGLVSFTPLNANTK 264

  Fly   236 PCATGVPDVHASVYFYRDWIR 256
            ||.......:..|..|.|||:
Mosquito   265 PCDPRKNTAYTDVAKYLDWIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/248 (26%)
Tryp_SPc 38..258 CDD:238113 67/250 (27%)
AgaP_AGAP005303XP_309096.4 Tryp_SPc 44..286 CDD:238113 66/247 (27%)
Tryp_SPc 44..284 CDD:214473 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.