DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP006707

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_309036.1 Gene:AgaP_AGAP006707 / 1270350 VectorBaseID:AGAP006707 Length:255 Species:Anopheles gambiae


Alignment Length:227 Identity:102/227 - (44%)
Similarity:136/227 - (59%) Gaps:1/227 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            |::||:.|::|.||||:|||.....|:|||:::|..:|||||||:.......:.|:.|||...: 
Mosquito    30 RVVGGEVAKNGSAPYQVSLQIPGHGHNCGGSLLNSRWVLTAAHCIVGHEPTNIQVLVGTNSLKE- 93

  Fly   102 GGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVL 166
            ||:.:......|.||.:||..|||.|:.|.|.:.:.|..|.|......:.....|.|||||.|..
Mosquito    94 GGQLYKPDKLFHHNYASPEFRNDIGLIRLKEEVQFSEIVQSIEYSEQVVPANVTVRLTGWGRTSA 158

  Fly   167 WGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLV 231
            .|:.|..||.|.:..:.:.:|||.....|..||||:||.||.|||||:||||||||..|.|||:|
Mosquito   159 GGSVPTLLQSLNVVTLTNEDCKAKSLYPEHVDVGHLCTLSRSGEGACNGDSGGPLVYEGKLVGVV 223

  Fly   232 NWGWPCATGVPDVHASVYFYRDWIRNVMSGNS 263
            |:|.||..|.||..|.|.:|.||||..|:.:|
Mosquito   224 NFGVPCGLGYPDGFARVSYYHDWIRTTMANDS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 97/217 (45%)
Tryp_SPc 38..258 CDD:238113 99/219 (45%)
AgaP_AGAP006707XP_309036.1 Tryp_SPc 30..247 CDD:214473 97/217 (45%)
Tryp_SPc 31..250 CDD:238113 99/219 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9682
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.990

Return to query results.
Submit another query.