DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CTR2_ANOGA

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_309032.2 Gene:CTR2_ANOGA / 1270347 VectorBaseID:AGAP006711 Length:258 Species:Anopheles gambiae


Alignment Length:254 Identity:102/254 - (40%)
Similarity:152/254 - (59%) Gaps:6/254 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLT 76
            :|.|:.::|.::.....|..:.  .|::||:.|::|.||||:|||.....|:|||:::|..:|||
Mosquito     9 VSVLLVVSAAKVTKLVLDDHYV--NRVVGGEVAKNGSAPYQVSLQVPGWGHNCGGSLLNNRWVLT 71

  Fly    77 AAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQ 141
            ||||:.......|:|:.|||...:.|....:..:..|..|:.|:.||||.|:.|.:|:.:.|..|
Mosquito    72 AAHCLVGYEPSDLMVLVGTNSLKEGGELLKVDKLLYHSRYNRPQFHNDIGLMRLEQPVQFSELVQ 136

  Fly   142 PIPL--PLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICT 204
            .:..  ..||:..  .|.|||||.|...|..|..||.|.:..:.:.:|||.:.|.::.|:||:||
Mosquito   137 SVEYLEKAVPVNA--TVRLTGWGRTSTNGNVPTLLQSLNVVTLSNEDCKAKMGNPKNVDLGHVCT 199

  Fly   205 FSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVMSGNS 263
            .::.|||||:||||||||..|.|||:||:|.||..|.||..|.|.:|.:|:|..|:.||
Mosquito   200 LTKAGEGACNGDSGGPLVYEGKLVGVVNFGVPCGRGFPDGFARVSYYHEWVRTTMANNS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 93/219 (42%)
Tryp_SPc 38..258 CDD:238113 94/221 (43%)
CTR2_ANOGAXP_309032.2 Tryp_SPc 32..250 CDD:214473 93/219 (42%)
Tryp_SPc 33..253 CDD:238113 94/221 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9682
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.980

Return to query results.
Submit another query.