DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP006869

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_308888.1 Gene:AgaP_AGAP006869 / 1270209 VectorBaseID:AGAP006869 Length:272 Species:Anopheles gambiae


Alignment Length:255 Identity:81/255 - (31%)
Similarity:118/255 - (46%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTA 77
            ||||...|....|           ||:||..|.....|||:||:. :|||.||.::|:..:.|:|
Mosquito    33 SGLVLPIAPPTSG-----------RIVGGFEANIADFPYQLSLRQ-NGAHICGASVISSNYALSA 85

  Fly    78 AHCVENAFIPWLVVVT--GTNKYNQPGGRYFLKA-IHIHCNYDNPEMHNDIALLELVEPIAWDER 139
            |||...|  |.:..:|  |.:.....||..|..| |..|.:|.:..:..|:.::.:.....   .
Mosquito    86 AHCTFPA--PPVAAITLRGGSTDRTAGGVVFQTAEIINHPSYSDSSLDFDVCVIRITTSFV---G 145

  Fly   140 TQPIPLPLVP----MQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG 200
            ....|:.|.|    ...|...:::|||:|...|..||:||.:.:..:....|:.:.......| .
Mosquito   146 ANIAPITLAPEGTDYPEGTRTMVSGWGATSAIGALPINLQAVEVPLISQESCRGVWGAASVTD-N 209

  Fly   201 HICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWP-CATGVPDVHASV------YFYRD 253
            .:|. |..|..||.|||||||.:||..:|:|:||.| |...:|.|:|.|      .|.||
Mosquito   210 MVCA-SEPGRDACGGDSGGPLTNNGRQIGIVSWGSPLCLGNLPGVYARVAAPSIRAFIRD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/231 (32%)
Tryp_SPc 38..258 CDD:238113 74/230 (32%)
AgaP_AGAP006869XP_308888.1 Tryp_SPc 46..259 CDD:214473 72/220 (33%)
Tryp_SPc 47..258 CDD:238113 70/218 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.