DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP007165

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_308603.4 Gene:AgaP_AGAP007165 / 1269949 VectorBaseID:AGAP007165 Length:275 Species:Anopheles gambiae


Alignment Length:307 Identity:75/307 - (24%)
Similarity:118/307 - (38%) Gaps:84/307 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAVVLLILLGL--------------SGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQ 52
            |:.:||::||.              ||..::||                   .|:.|..|..|:.
Mosquito     3 SSTLLLLVLGCVLPAAEIVALHCNPSGSENVTA-------------------NGRPAYAGQFPHH 48

  Fly    53 ISLQ---GISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTN--------KYNQPGGRYF 106
            ..|.   |......|.||:::|..|:|.|.||..:  ..:.|..|:|        |:     ||.
Mosquito    49 ALLVVRFGEEETRHCSGALVDEKHVVTVAQCVVGS--SSVEVHLGSNCLLADESDKF-----RYV 106

  Fly   107 LKAIH--IHCNYDNPEMHNDIALL----ELVEPIAWDERTQPIPLPLV--PMQPGDEVILTGWGS 163
            ..|:.  :...||.....||:|::    |.|....|   .:|:.||..  ....|.||:.:|:| 
Mosquito   107 FTAVEFTVRDGYDTETFVNDVAVVRFTDEAVRLPPW---VKPVRLPEADEDQYVGQEVVTSGYG- 167

  Fly   164 TVLWGT--SPIDLQVLYLQYVPHRECKALLSNDEDCD-----VGHICTFSRLGEGACHGDSGGPL 221
            .:.:||  :...||.:.|..:....|:|      :.|     .|..|......|..|..|.|.||
Mosquito   168 LMDYGTDGAADGLQYMRLVVLELEACQA------EFDFVMPGTGRFCAQEADHERNCVSDVGSPL 226

  Fly   222 V------SNGYLVGLVNWG--WPCATGVPDVHASVYFYRDWIRNVMS 260
            |      ....|:||.::|  :.|:.|.|.....:..:..|:|:|:|
Mosquito   227 VRKEGRLQEYVLLGLTSFGQKFACSQGNPGALQEMREHATWVRDVLS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 62/251 (25%)
Tryp_SPc 38..258 CDD:238113 64/253 (25%)
AgaP_AGAP007165XP_308603.4 Tryp_SPc 36..256 CDD:214473 61/236 (26%)
Tryp_SPc 36..256 CDD:238113 61/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.