DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP007252

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_308550.4 Gene:AgaP_AGAP007252 / 1269896 VectorBaseID:AGAP007252 Length:305 Species:Anopheles gambiae


Alignment Length:238 Identity:69/238 - (28%)
Similarity:110/238 - (46%) Gaps:24/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGI--SGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99
            ||:.|..|:.|..|||:::...  :|:..|||:::...:||||||||:.:....::........|
Mosquito    63 RIVNGYVAQPGQFPYQVAILSTFPTGSGLCGGSVLTANYVLTAAHCVDVSNGGLVIYGAQDRTVN 127

  Fly   100 QPGGR---YFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGW 161
            :|..:   :....:.:|.|::...:..|||.:.:|.|:.:.:|.||:.||.:.....|...|.|.
Mosquito   128 EPSQQRIAFEQSGVRLHPNWNPALIRYDIATIRVVSPVTFSDRIQPVTLPRLSDVGNDFAGLIGT 192

  Fly   162 GSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDV--------GHICTFSRLGEGACHGDSG 218
            .|.....:..|......|:||.:.     :..:..|.|        .:||.....|.|||.||||
Mosquito   193 VSGFGRFSDSIQEASAILRYVNNP-----IQTNLACSVRFPGVVQPENICLSGDSGRGACQGDSG 252

  Fly   219 GPL--VSNGYLV--GLVNWGWP--CATGVPDVHASVYFYRDWI 255
            |||  |.:|..|  |:|::|..  |....|.|.|....:..||
Mosquito   253 GPLTIVRDGTTVQLGVVSFGLALGCELNWPSVFARTTSFLAWI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 67/236 (28%)
Tryp_SPc 38..258 CDD:238113 68/237 (29%)
AgaP_AGAP007252XP_308550.4 Tryp_SPc 63..295 CDD:214473 67/236 (28%)
Tryp_SPc 64..295 CDD:238113 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.